PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI05G01980.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 1684aa    MW: 182733 Da    PI: 7.1056
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI05G01980.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.31.5e-07831873347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +W +eE e++ +  + +G++ +++I++ ++ ++t  +c+++++k+
  OMERI05G01980.3 831 PWIQEEKEIFMEKLATFGKD-FSKISSFLQ-HKTTADCIEFYYKH 873
                      899***************99.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.77E-13814876IPR009057Homeodomain-like
PROSITE profilePS5129314.547827878IPR017884SANT domain
SMARTSM007174.8E-7828876IPR001005SANT/Myb domain
PfamPF002491.0E-5831873IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-5831875IPR009057Homeodomain-like
PROSITE profilePS5129313.72810361087IPR017884SANT domain
SMARTSM007176.6E-410371085IPR001005SANT/Myb domain
SuperFamilySSF466891.56E-810411087IPR009057Homeodomain-like
CDDcd001670.0012910411079No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1684 aa     Download sequence    Send to blast
MRRPELGIRA GWTTTTTTTT PWMPPPPPDR RDFLYRDGRR HDGDPLPPPA PTPPRWRDSP  60
YHPPPPPPPP LRDHSRPSPR RTPSSASSGR PFAYKSSDLM LPPPPPPPWT SPPPLIRRNR  120
SAISDGYYRQ GGGSYDRSYP DESLGYTPSR SDRYWLDDDS GGGYKGFSRY GGGGGGSRRD  180
GRDMRGSYRR SPFRGYGSDF SRNHQEHPPP PLRRSPLRSV AVPMSYDPPG DRADRGDRDH  240
HHRVTPWRPL RRRESRSDAA DAAGAGPVPV GQAAAAAASE KDVSARSSAV AAPQVSEEEA  300
PRKKPRLGWG QGLAKYEKQK VQGPAESAEA VAEGSPTATE QKGVTHTPAP APCVSPVTAP  360
SPAPCASPVA APSPAPCASP VAAPSPALPC KSPVPEDKSC ELTANTVTEF NKNIPGPDVQ  420
ACNNEVPTKL DQLEGDPIDS LAKVLSELVQ HEDSCSGDSK RLSNVSKLLL LKESISKELE  480
KTELEIDSLE GELKSVNVEA RNRTLKDPPT AVTYAQNPLP SPVKEQGELT PSPKISMEQD  540
ADVKGSELME VETAQAHNAK AVSSEESVAC PGVAPGQVPA AADVIPSDPC GKTGSGIDVD  600
IEQREENPCQ ENFNAMKADG SSDLATRPCS YRDVKYNLMD QIIAANRSEA KKNSQLLFKP  660
VPADRSNLDL LASSYLSSQM KNDVIIKKKH AILKNRQRFK EQILTFKFRV LRHLWKEDVR  720
LLSVRKQRSK SHKRTDQSNR SSQSGSQRQR SSNRSRLAVP AGNLSTFPIT EMSGVAKKLF  780
SEFQLKRCRN YLKMPALIVD EKEKAGAKFV SKNGLVEDPV SVEKERALIN PWIQEEKEIF  840
MEKLATFGKD FSKISSFLQH KTTADCIEFY YKHHKSDSFR EVKKLLDLRQ QQQPASNYLG  900
AVSGKKWNPE ANAASLDMLG VATEVAAQGL EYVNEVKKNS AKSILRTVCG VDNSTKGSEK  960
DSVGDVSLHE RESVAADVLA GICGTLSPEG MGSCITSSAD PGQKIGIISR MEHLLTPEAD  1020
KNFDDDGTLS DQECEVDIVD WNDDEKSSFI EAMNRYGKDF ARISSYVKSK SFEQCKVFFS  1080
KARKSLGLDL IHQGAADAGF PTGDANGGRS GTDGACIAEM DSAICSAQSC PKVEIDACPV  1140
SDGEIQGHNP LSYIASRQPE ADKSNMPDVV DINVEEGESK AEKDCSILVD HKQLREDTNQ  1200
TSCACIDINC PESTDKLQDI EDVTPVNMHG DDLMATSVEQ AVAAHVESRS SLHSEGIGID  1260
FSRIEGCSHE STIGKGGKST PSVCLPAANG VSKENIIHFS NMDGASSISP AFTSNYQQSK  1320
LADPIQSKPK PLTPKDLMPV QFSSSLPDPT SICFEGIAAI TTPNFEDHGN RASIASGAKD  1380
VNMFPTFKDQ SSNRHDALFS NVDGYMQQRR NNHFGTEVCG LSESTGISQS DQFTVSKFQN  1440
GRPSSLGLSN GNLGVLSTGR REEAREGLFR PCSVKTSAGN EEQQKRPGDV KLFGQILSHQ  1500
SSLQSSGSSV HGSKSKPPSP KVDKSASSRL LSNPRERLVY SSRPPITANL GLEERAMRSF  1560
DHMDGRTIQP EPMVMVAKCQ RPSAGVPVYS TKNGALSVFA EFQQPSMPPH TSDHKLLENF  1620
ADLHKRNGIE LLSGFQQPGR LGGAGVLVSG VSDPVAALKA QYGSGSKMLS SSNDVDTWKD  1680
IGSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C5e-16789880494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D5e-16789880494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0706530.0AK070653.1 Oryza sativa Japonica Group cDNA clone:J023055D14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639126.10.0PREDICTED: uncharacterized protein LOC9268524
RefseqXP_015639127.10.0PREDICTED: uncharacterized protein LOC9268524
RefseqXP_015639128.10.0PREDICTED: uncharacterized protein LOC9268524
RefseqXP_015639129.10.0PREDICTED: uncharacterized protein LOC9268524
TrEMBLA0A0E0DLF50.0A0A0E0DLF5_9ORYZ; Uncharacterized protein
STRINGBGIOSGA018896-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.17e-76MYB family protein